PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 256aa    MW: 28464.9 Da    PI: 6.7936
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031118.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.52.7e-5527121397
        NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  eqdr+lPianvsrimkk lPanakisk+aketvqecvsefisf+t+eas+kcqrekrktingddllwa++tlGfe+yv plkvyl++yr++egek
  CCG031118.1  27 EQDRLLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASEKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVYLNRYRDTEGEK 121
                  8*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.5E-5322139IPR009072Histone-fold
SuperFamilySSF471131.71E-4028141IPR009072Histone-fold
PfamPF008082.5E-273195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.5E-195977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.5E-197896No hitNo description
PRINTSPR006155.5E-1997115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTGKRTRISP IGSPLSENIS ESSSKLEQDR LLPIANVSRI MKKSLPANAK ISKEAKETVQ  60
ECVSEFISFI TGEASEKCQR EKRKTINGDD LLWAMTTLGF ENYVGPLKVY LNRYRDTEGE  120
KNSMARQEDQ LSPTNHGSLG THETIKVNGS SSLSTGMDLQ SSNAGHYSLG TEVTARSYGQ  180
NTRFFGFQES SMVGDFNMNT IRDHGDRNGN IAMAACEIKT AVVYLLNTPN MKHQPMSEAE  240
DQDIMILQSQ VNHSKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4627116392Transcription factor HapC (Eurofung)
4g92_B2e-4627116392Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ1618800.0HQ161880.1 Populus euphratica nuclear transcription factor Y-alpha (NFYA) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025616.11e-159PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLF8RS741e-147F8RS74_POPEU; Nuclear transcription factor Y-alpha (Fragment)
STRINGPOPTR_0007s06480.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.17e-61nuclear factor Y, subunit B3